Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Salivary antigen 1 protein

This Insect Salivary antigen 1 protein spans the amino acid sequence from region 19-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FS-I Allergen, Cte f 1

UniProt

Q94424

Expression Region

19-176aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ctenocephalides felis (Cat flea)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDIWKVNKKCTSGGKNQDRKLDQIIQKGQQVKIQNICKLIRDKPHTNQEKEKCMKFCKKVCKGYRGACDGNICYCSRPSNLGPDWKVSKECKDPNNKDSRPTEIVPYRQQLAIPNICKLKNSETNEDSKCKKHCKEKCRGGNDAGCDGNFCYCRPKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Epdr1 shRNA (UAS) - Lentiviral mouseEpdr1 shRNA (UAS, GFP) (25)
GTR15263552 1 Vial

Lentiviral mouse Epdr1 shRNA (UAS) - Lentiviral mouseEpdr1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Human ADAM15 / MDC15 Protein (His tag)
E53A07087 50 µg

Recombinant Human ADAM15 / MDC15 Protein (His tag)

Sign In for Pricing
View Details
CNOT6L Antibody - middle region
ARP66542_P050-25UL 25 µL

CNOT6L Antibody - middle region

Sign In for Pricing
View Details
Orange Oil extrapure
70855-01 100 mL

Orange Oil extrapure

Sign In for Pricing
View Details
Orange Oil extrapure
70855-02 500 mL

Orange Oil extrapure

Sign In for Pricing
View Details
Ethyl 2- (2-oxopyrrolidin-3-yl) acetate
OR1054362-01 100 mg

Ethyl 2- (2-oxopyrrolidin-3-yl) acetate

Sign In for Pricing
View Details