Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Salivary antigen 1 protein

This Insect Salivary antigen 1 protein spans the amino acid sequence from region 19-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FS-I Allergen, Cte f 1

UniProt

Q94424

Expression Region

19-176aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ctenocephalides felis (Cat flea)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDIWKVNKKCTSGGKNQDRKLDQIIQKGQQVKIQNICKLIRDKPHTNQEKEKCMKFCKKVCKGYRGACDGNICYCSRPSNLGPDWKVSKECKDPNNKDSRPTEIVPYRQQLAIPNICKLKNSETNEDSKCKKHCKEKCRGGNDAGCDGNFCYCRPKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SIGLEC5 shRNA Plasmid
abx982034-01 150 µg

Mouse SIGLEC5 shRNA Plasmid

Sign In for Pricing
View Details
Mouse SIGLEC5 shRNA Plasmid
abx982034-02 300 µg

Mouse SIGLEC5 shRNA Plasmid

Sign In for Pricing
View Details
Vesnarinone
C01687-5mg 5 mg

Vesnarinone

Sign In for Pricing
View Details
Rat Stip1 Pre-designed siRNA Set B
SI213892B 1 Each

Rat Stip1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human ERBB2 (V956R) BAF3 Cell Line
ABC-X0286C 1 Vial

Human ERBB2 (V956R) BAF3 Cell Line

Sign In for Pricing
View Details
4-Hydroxy-2-hexenal Antibody (ATTO594)
abx448646-01 10x 96 Tests

4-Hydroxy-2-hexenal Antibody (ATTO594)

Sign In for Pricing
View Details