Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Disintegrin halysin protein

This Reptile Disintegrin halysin protein spans the amino acid sequence from region 1-71aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Platelet aggregation activation inhibitor

UniProt

P21858

Expression Region

1-71aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASTE1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-9297R-PE-Cy5 100 µL

ASTE1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Lentiviral human RNGTT sgRNA gene knockout kit - Lentiviral human RNGTT sgRNA gene knockout kit (25)
GTR15400116 1 Vial

Lentiviral human RNGTT sgRNA gene knockout kit - Lentiviral human RNGTT sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MLF1/MLF2 Rabbit Polyclonal Antibody (FITC)
orb3934 100 µL

MLF1/MLF2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
T-cell-specific Surface Glycoprotein CD28, Recombinant, Human, aa19-152, hFc-Tag
586459-01 20 µg

T-cell-specific Surface Glycoprotein CD28, Recombinant, Human, aa19-152, hFc-Tag

Sign In for Pricing
View Details
T-cell-specific Surface Glycoprotein CD28, Recombinant, Human, aa19-152, hFc-Tag
586459-02 100 µg

T-cell-specific Surface Glycoprotein CD28, Recombinant, Human, aa19-152, hFc-Tag

Sign In for Pricing
View Details
Mouse SFRP4 HEK293 Overexpression Lysate
MBS8116332-01 0.3 mg

Mouse SFRP4 HEK293 Overexpression Lysate

Sign In for Pricing
View Details