Pig Major pepsin inhibitor 3 protein
This Pig Major pepsin inhibitor 3 protein spans the amino acid sequence from region 21-169aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Short name, PI-3
UniProt
P19400
Expression Region
21-169aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
Field of Research
Neuroscience; Pharmacology & Drug Discovery
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741132-100 1x 100 µL
CD45RB (PTPRC/1132), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401859-100 1x 100 µL
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881683-500 1x 500 µL
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details