Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Trem2 protein

This Mouse Trem2 protein spans the amino acid sequence from region 19-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, TREM-2 Alternative name (s), Triggering receptor expressed on monocytes 2

UniProt

Q99NH8

Expression Region

19-171aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDI1 Rabbit Polyclonal Antibody
orb1742316 100 µL

GDI1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMGN5 Recombinant Protein (Human)
RP063003 100 µg

HMGN5 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-c-Maf/MAF Antibody Picoband®
A00654-1 100 µg/Vial

Anti-c-Maf/MAF Antibody Picoband®

Sign In for Pricing
View Details
Human Growth Arrest Specific Protein 2 (GAS2) Antibody Pair Kit (with Standard)
MBS2098597-01 5x 96 Tests

Human Growth Arrest Specific Protein 2 (GAS2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Growth Arrest Specific Protein 2 (GAS2) Antibody Pair Kit (with Standard)
MBS2098597-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Growth Arrest Specific Protein 2 (GAS2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Growth Arrest Specific Protein 2 (GAS2) Antibody Pair Kit (with Standard)
MBS2098597-03 10x 96 Tests

Human Growth Arrest Specific Protein 2 (GAS2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details