Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Bglap protein

This Mouse Bglap protein spans the amino acid sequence from region 50-95aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone Gla protein Short name, BGP Gamma-carboxyglutamic acid-containing protein

UniProt

P86546

Expression Region

50-95aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Micro Slide Internal Section of Animal Cell Slide
406040G/1 1 Each

Micro Slide Internal Section of Animal Cell Slide

Sign In for Pricing
View Details
Connexin-45 Rabbit Polyclonal Antibody (Cy5)
orb914588 100 µL

Connexin-45 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
FIBIN Antibody Blocking Peptide
orb1511315 500 µg

FIBIN Antibody Blocking Peptide

Sign In for Pricing
View Details
Gynuramide II
380416 5 mg

Gynuramide II

Sign In for Pricing
View Details
C12orf56 Rabbit Polyclonal Antibody (HRP)
orb2088581 100 µL

C12orf56 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
SCLT1, CT (SCLT1, SAP1, Sodium channel and clathrin linker 1, Sodium channel-associated protein 1) (Biotin)
MBS6345307-01 0.2 mL

SCLT1, CT (SCLT1, SAP1, Sodium channel and clathrin linker 1, Sodium channel-associated protein 1) (Biotin)

Sign In for Pricing
View Details