Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SIGLEC15 protein

This Human SIGLEC15 protein spans the amino acid sequence from region 20-263aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD33 antigen-like 3

UniProt

Q6ZMC9

Expression Region

20-263aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAI1 Polyclonal Antibody
E-AB-40651-01 25 µL

PAI1 Polyclonal Antibody

Sign In for Pricing
View Details
PAI1 Polyclonal Antibody
E-AB-40651-02 100 µL

PAI1 Polyclonal Antibody

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2865), CF640R conjugate, 0.1mg/mL
BNC402865-500 1x 500 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2865), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPS12 (NM_001016) Human Over-expression Lysate
LC423138 20 µg

RPS12 (NM_001016) Human Over-expression Lysate

Sign In for Pricing
View Details
Dimethyl Lys4 Histone H3 Polyclonal Antibody
A006-100UL 1 Each

Dimethyl Lys4 Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
FOXD1 Human Gene Knockout Kit (CRISPR)
KN420504 1 Kit

FOXD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details