Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Oxyopinin-4a protein

This Insect Oxyopinin-4a protein spans the amino acid sequence from region 48-77aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oxt-4a

UniProt

F8J4S0

Expression Region

48-77aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Oxyopes takobius (Lynx spider) (Oxyopes foliiformis)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4D1 Antibody
8G591-AAT 50 µg

OR4D1 Antibody

Sign In for Pricing
View Details
Butyl 2-Ethylhexanoate
TRC-B684437-500MG 500 mg

Butyl 2-Ethylhexanoate

Sign In for Pricing
View Details
ACSL1 (NM_001995) Human Over-expression Lysate
LY419599 100 µg

ACSL1 (NM_001995) Human Over-expression Lysate

Sign In for Pricing
View Details
GATA4 Rabbit Polyclonal Antibody
R1107-5 100 µL

GATA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
6-Amino-9H-purine-9-propanoic Acid
TRC-A628895-5G 5 g

6-Amino-9H-purine-9-propanoic Acid

Sign In for Pricing
View Details
LRRC48 (DRC3) (NM_001130090) Human Over-expression Lysate
LC427158 20 µg

LRRC48 (DRC3) (NM_001130090) Human Over-expression Lysate

Sign In for Pricing
View Details