Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LAMA5 protein

This Human LAMA5 protein spans the amino acid sequence from region 3401-3692aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Laminin-10 subunit alpha Laminin-11 subunit alpha Laminin-15 subunit alpha

UniProt

O15230

Expression Region

3401-3692aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF22 Polyclonal Antibody
E-AB-16546-01 20 µL

KIF22 Polyclonal Antibody

Sign In for Pricing
View Details
KIF22 Polyclonal Antibody
E-AB-16546-02 60 µL

KIF22 Polyclonal Antibody

Sign In for Pricing
View Details
KIF22 Polyclonal Antibody
E-AB-16546-03 120 µL

KIF22 Polyclonal Antibody

Sign In for Pricing
View Details
KIF22 Polyclonal Antibody
E-AB-16546-04 200 µL

KIF22 Polyclonal Antibody

Sign In for Pricing
View Details
Human IL-4 (Interleukin 4) ELISPOT Kit
ESP-H0007-01 96 Tests

Human IL-4 (Interleukin 4) ELISPOT Kit

Sign In for Pricing
View Details
Human IL-4 (Interleukin 4) ELISPOT Kit
ESP-H0007-02 5x 96 Tests

Human IL-4 (Interleukin 4) ELISPOT Kit

Sign In for Pricing
View Details