Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial bla protein

This Bacterial bla protein spans the amino acid sequence from region 25-293aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carbapenem-hydrolyzing beta-lactamase KPC-2

UniProt

Q848S6

Expression Region

25-293aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Klebsiella oxytoca

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)
MBS2067249-01 0.1 mL

APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)
MBS2067249-02 0.2 mL

APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)
MBS2067249-03 0.5 mL

APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)
MBS2067249-04 1 mL

APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)
MBS2067249-05 5 mL

APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)
MBS2067249-06 5x 5 mL

APC-Linked Polyclonal Antibody to Microseminoprotein Beta (MSMb)

Sign In for Pricing
View Details