Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial bla protein

This Bacterial bla protein spans the amino acid sequence from region 25-293aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carbapenem-hydrolyzing beta-lactamase KPC-2

UniProt

Q848S6

Expression Region

25-293aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Klebsiella oxytoca

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

REC114 (NM_001042367) Human Recombinant Protein
TP318438L 1 mg

REC114 (NM_001042367) Human Recombinant Protein

Sign In for Pricing
View Details
Cluster of Differentiation 81 (CD81) Antibody
abx146510 100 µg

Cluster of Differentiation 81 (CD81) Antibody

Sign In for Pricing
View Details
HIST1H2AG AAV Vector (Mouse) (CMV)
23318104 1 µg

HIST1H2AG AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
AP-24600
T21453 25 mg

AP-24600

Sign In for Pricing
View Details
PDIA2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61394R-BF594-01 20 µL

PDIA2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
PDIA2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61394R-BF594-02 100 µL

PDIA2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details