Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial lptD protein

This Bacterial lptD protein spans the amino acid sequence from region 73-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LptD, imp, ostA, STY0108, t0096LPS-assembly protein LptD

UniProt

Q8Z9J6

Expression Region

73-169aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Salmonella typhi

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CTPS2 Recombinant Protein
PPT-12107 100 µg

Human CTPS2 Recombinant Protein

Sign In for Pricing
View Details
DRD5P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV723359 1.0 µg DNA

DRD5P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
YbeH Antibody
orb830004 2 mg

YbeH Antibody

Sign In for Pricing
View Details
Ankyrin repeat domain-containing protein 45 (ANKRD45) Mouse ELISA Kit
B5232 96 Tests

Ankyrin repeat domain-containing protein 45 (ANKRD45) Mouse ELISA Kit

Sign In for Pricing
View Details
Human Leptin ELISA Kit
EHL0045 96 Tests

Human Leptin ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MRPL7 Polyclonal Antibody
MBS7158322 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MRPL7 Polyclonal Antibody

Sign In for Pricing
View Details