Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Znf346 protein

This Mouse Znf346 protein spans the amino acid sequence from region 1-294aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Just another zinc finger protein

UniProt

Q9R0B7

Expression Region

1-294aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MECPAPDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQTPVQTQPTPKDSSTVQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF688 AAV siRNA Pooled Vector
51730161 1.0 µg

ZNF688 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant MeV M/Matrix protein Protein, N-His
YVV34701 100 μg

Recombinant MeV M/Matrix protein Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ZNF525 Protein
E30P12370 20 µg

Recombinant Human ZNF525 Protein

Sign In for Pricing
View Details
Rac-3-Hydroxypentanoic Acid-D3
sc-491209 2.5 mg

Rac-3-Hydroxypentanoic Acid-D3

Sign In for Pricing
View Details
Lentiviral mouse Krr1 shRNA (UAS) - Lentiviral mouse Krr1 shRNA (UAS, iRFP) (25)
GTR15170210 1 Vial

Lentiviral mouse Krr1 shRNA (UAS) - Lentiviral mouse Krr1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ZIC3 (Zic Family Member 3 (odd-Paired Homolog, Drosophila), HTX, HTX1, ZNF203) (HRP)
253624-HRP 100 µL

ZIC3 (Zic Family Member 3 (odd-Paired Homolog, Drosophila), HTX, HTX1, ZNF203) (HRP)

Sign In for Pricing
View Details