Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial scn protein

This Bacterial scn protein spans the amino acid sequence from region 32-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SCIN

UniProt

Q99SU9

Expression Region

32-116aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain N315)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Immunoglobulin Heavy Constant Mu (IGHM) ELISA Kit
RD-IGHM-Hu-01 48 Tests

Human Immunoglobulin Heavy Constant Mu (IGHM) ELISA Kit

Sign In for Pricing
View Details
Human Immunoglobulin Heavy Constant Mu (IGHM) ELISA Kit
RD-IGHM-Hu-02 96 Tests

Human Immunoglobulin Heavy Constant Mu (IGHM) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CCL11 Protein
E30PQ203 20 µg

Recombinant Human CCL11 Protein

Sign In for Pricing
View Details
Human TIPARP Pre-designed siRNA Set A
SI016672A 1 Each

Human TIPARP Pre-designed siRNA Set A

Sign In for Pricing
View Details
C12orf36 (NM_182558) Human Tagged Lenti ORF Clone
RC224013L3 10 µg

C12orf36 (NM_182558) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
(2E) -3- (2,3-dichlorophenyl) acrylic acid
sc-275551 1 g

(2E) -3- (2,3-dichlorophenyl) acrylic acid

Sign In for Pricing
View Details