Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial scn protein

This Bacterial scn protein spans the amino acid sequence from region 32-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SCIN

UniProt

Q99SU9

Expression Region

32-116aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain N315)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perilipin-2/ADFP Blocking Peptide - (Dry Ice)
NB110-40878PEP 0.05 mg

Perilipin-2/ADFP Blocking Peptide - (Dry Ice)

Sign In for Pricing
View Details
Rabbit Monoclonal SOX10 Antibody (2447A) [HRP]
FAB28642H 0.1 mL

Rabbit Monoclonal SOX10 Antibody (2447A) [HRP]

Sign In for Pricing
View Details
FOXJ3 AAV Vector (Human) (CMV)
20778101 1 µg

FOXJ3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rat Bcas3 Pre-designed siRNA Set B
SI201339B 1 Each

Rat Bcas3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CDK2 Antibody
orb1323102-01 30 µL

CDK2 Antibody

Sign In for Pricing
View Details
CDK2 Antibody
orb1323102-02 50 μL

CDK2 Antibody

Sign In for Pricing
View Details