Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial lspL protein

This Bacterial lspL protein spans the amino acid sequence from region 1-341aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UDP-glucuronic acid epimerase

UniProt

O54067

Expression Region

1-341aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRYLITGTAGFIGFHVAKRLIDEGHFVVGFDGMTPYYDVTLKERRHAILQRSNGFKAVTAMLEDRAALDRAAELAEPEVIIHLAAQAGVRYSLENPKAYVDANLVGSWNMLELAKAIAPKHLMLASTSSIYGANEKIPFAEADRADEPMTLYAATKKSMELMAHSYAHLYKVPTTSFRFFTVYGPWGRPDMALFKFVDAIHNGRPIDIYGEGRMSRDFTYIDDLVESIVRLSHVPPSEENRVAPEKATDTLSRHAPFRVVNTGGGQPVELMTFVETVEKAVGRPAIHNMLPMQQGDVPRTFASPDLLEALTGFKPSVSVEEGVARFVEWYDQNYRRAHTTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Human CD61 mAb (APC)
orb2710022 100 Tests

Mouse Anti-Human CD61 mAb (APC)

Sign In for Pricing
View Details
TUSC5 Conjugated Antibody
orb1623649 100 µL

TUSC5 Conjugated Antibody

Sign In for Pricing
View Details
RABL5 siRNA (Mouse)
MBS8234465-01 15 nmol

RABL5 siRNA (Mouse)

Sign In for Pricing
View Details
RABL5 siRNA (Mouse)
MBS8234465-02 30 nmol

RABL5 siRNA (Mouse)

Sign In for Pricing
View Details
RABL5 siRNA (Mouse)
MBS8234465-03 5x 30 nmol

RABL5 siRNA (Mouse)

Sign In for Pricing
View Details
ANAPC5 Conjugated Antibody
orb1621912 100 µL

ANAPC5 Conjugated Antibody

Sign In for Pricing
View Details