Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal BLOT5 protein

This Animal BLOT5 protein spans the amino acid sequence from region 1-134aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen, Blo t 5

UniProt

O96870

Expression Region

1-134aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Blomia tropicalis (Mite)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF9 Antibody
KC-2112-01 50 μL

IRF9 Antibody

Sign In for Pricing
View Details
IRF9 Antibody
KC-2112-02 100 µL

IRF9 Antibody

Sign In for Pricing
View Details
IRF9 Antibody
KC-2112-03 1 mL

IRF9 Antibody

Sign In for Pricing
View Details
N1,N3-Dibenzyl-N1,N3-bis(2-chloroethyl)propane-1,3-diamine Dihydrochloride
TRC-D760520-500MG 500 mg

N1,N3-Dibenzyl-N1,N3-bis(2-chloroethyl)propane-1,3-diamine Dihydrochloride

Sign In for Pricing
View Details
UBAC2 Human Gene Knockout Kit (CRISPR)
KN420266 1 Kit

UBAC2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NFKB1 pSer337 Rabbit Polyclonal Antibody
AP01644PU-N 100 µg

NFKB1 pSer337 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details