Dog Mite group 2 allergen Lep d 2 protein
This Dog Mite group 2 allergen Lep d 2 protein spans the amino acid sequence from region 17-141aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Allergen Lep d 1 Allergen Lep d I Allergen, Lep d 2
UniProt
P80384
Expression Region
17-141aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Lepidoglyphus destructor (Storage mite) (Glycyphagus destructor)
Field of Research
Epigenetics
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC050017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040029-100 1x 100 µL
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880525-100 1x 100 µL
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details