Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Cytotoxin 4 protein

This Reptile Cytotoxin 4 protein spans the amino acid sequence from region 22-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cardiotoxin A4 Short name, CTX A4 Cardiotoxin analog IV Short name, CTX IV

UniProt

P01443

Expression Region

22-81aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Naja atra (Chinese cobra)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G6B siRNA (Human)
CRJ2893-01 15 nmol

G6B siRNA (Human)

Sign In for Pricing
View Details
G6B siRNA (Human)
CRJ2893-02 30 nmol

G6B siRNA (Human)

Sign In for Pricing
View Details
ROBO2 (NM_002942) Human Tagged ORF Clone
RC224282 10 µg

ROBO2 (NM_002942) Human Tagged ORF Clone

Sign In for Pricing
View Details
PPM1D (Protein Phosphatase 1D, Protein Phosphatase 2C Isoform delta, PP2C-delta, Protein Phosphatase Magnesium-dependent 1 delta, p53-induced Protein Phosphatase 1, WIP1) (PE)
131668-PE 100 µL

PPM1D (Protein Phosphatase 1D, Protein Phosphatase 2C Isoform delta, PP2C-delta, Protein Phosphatase Magnesium-dependent 1 delta, p53-induced Protein Phosphatase 1, WIP1) (PE)

Sign In for Pricing
View Details
Akr7a2 (NM_134407) Rat Untagged Clone
RN200557 10 µg

Akr7a2 (NM_134407) Rat Untagged Clone

Sign In for Pricing
View Details
ATP5C1 Double Nickase Plasmid (m)
sc-419248-NIC 20 µg

ATP5C1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details