Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Cytotoxin 4 protein

This Reptile Cytotoxin 4 protein spans the amino acid sequence from region 22-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cardiotoxin A4 Short name, CTX A4 Cardiotoxin analog IV Short name, CTX IV

UniProt

P01443

Expression Region

22-81aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Naja atra (Chinese cobra)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNAI1 Recombinant Rabbit mAb, BF350 conjugated
orb3124917 100 µL

SNAI1 Recombinant Rabbit mAb, BF350 conjugated

Sign In for Pricing
View Details
MSL3L1 Antibody - C-terminal region : FITC (ARP39784_T100-FITC)
ARP39784_T100-FITC 100 µL

MSL3L1 Antibody - C-terminal region : FITC (ARP39784_T100-FITC)

Sign In for Pricing
View Details
KRT35, CT (KRT35, HHA5, HKA5, KRTHA5, Keratin, type I cuticular Ha5, Hair keratin, type I Ha5, Keratin-35) (MaxLight 550) discontinued
037618-ML550 100 µL

KRT35, CT (KRT35, HHA5, HKA5, KRTHA5, Keratin, type I cuticular Ha5, Hair keratin, type I Ha5, Keratin-35) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Caki-1 Cell Line
RWT-979 1x 10^6

Caki-1 Cell Line

Sign In for Pricing
View Details
Bovine R3H domain containing 2 ELISA Kit
OM621544 96 Strip Well

Bovine R3H domain containing 2 ELISA Kit

Sign In for Pricing
View Details
Troponin I (fast skeletal muscle (TNNI2) Human ELISA Kit
H9141 96 Tests

Troponin I (fast skeletal muscle (TNNI2) Human ELISA Kit

Sign In for Pricing
View Details