Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey EPO protein

This Monkey EPO protein spans the amino acid sequence from region 28-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPOErythropoietin

UniProt

P07865

Expression Region

28-192aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIL6 Lentiviral Activation Particles (h2)
sc-415440-LAC-2 200 µL

PPIL6 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
MAPK9 AAV Vector (Mouse) (CMV)
28076105 1 µg

MAPK9 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Anti-CD93  (1A4)
YF-MA17759 100 ug

Anti-CD93 (1A4)

Sign In for Pricing
View Details
YmgG Antibody
orb836109 2 mg

YmgG Antibody

Sign In for Pricing
View Details
Mx2 HDR Plasmid (h)
sc-400697-HDR 20 µg

Mx2 HDR Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human GAB1 Protein, N-His
E55P2355 50 µg

Recombinant Human GAB1 Protein, N-His

Sign In for Pricing
View Details