Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fcgr3 protein

This Mouse Fcgr3 protein spans the amino acid sequence from region 31-215aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc-gamma RIII Short name, FcRIII CD_antigen, CD16

UniProt

P08508

Expression Region

31-215aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lincomycin Hydrochloride
TRC-L466200-25G 25 g

Lincomycin Hydrochloride

Sign In for Pricing
View Details
Ethyl 4-Acetamidobenzoate
TRC-E894700-500MG 500 mg

Ethyl 4-Acetamidobenzoate

Sign In for Pricing
View Details
HER-4 / ERBB4 (ERBB4/2581), CF568 conjugate, 0.1mg/mL
BNC682581-500 1x 500 µL

HER-4 / ERBB4 (ERBB4/2581), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CD55/DAF Protein (Fc Tag)
PKSH031879 100 µg

Recombinant Human CD55/DAF Protein (Fc Tag)

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), Biotin conjugate, 0.1mg/mL
BNCB2501-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2501), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCAT1 (NM_005504) Human Over-expression Lysate
LC401683 20 µg

BCAT1 (NM_005504) Human Over-expression Lysate

Sign In for Pricing
View Details