Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fcgr3 protein

This Mouse Fcgr3 protein spans the amino acid sequence from region 31-215aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc-gamma RIII Short name, FcRIII CD_antigen, CD16

UniProt

P08508

Expression Region

31-215aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAB1 Rabbit Polyclonal Antibody
HA500400 100 µL

TAB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tnni3 (NM_009406) Mouse Tagged ORF Clone
MG202282 10 µg

Tnni3 (NM_009406) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
(5S)-N-(5-Amino-1-carboxypentyl)iminodiacetic Acid
TRC-A603250-5G 5 g

(5S)-N-(5-Amino-1-carboxypentyl)iminodiacetic Acid

Sign In for Pricing
View Details
Tex29 Mouse Gene Knockout Kit (CRISPR)
KN517444 1 Kit

Tex29 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TFIIA2 (GTF2A2) Human Gene Knockout Kit (CRISPR)
KN401117 1 Kit

TFIIA2 (GTF2A2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant MYO1B Antibody
RC-5188-01 50 μL

Recombinant MYO1B Antibody

Sign In for Pricing
View Details