Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Nkx2-2 protein

This Mouse Nkx2-2 protein spans the amino acid sequence from region 1-273aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Homeobox protein NK-2 homolog B

UniProt

P42586

Expression Region

1-273aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hemoglobin alpha Rabbit Polyclonal Antibody (BF405)
orb2372157 100 µL

Hemoglobin alpha Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
RETN Antibody
orb1272664 0.5 mg

RETN Antibody

Sign In for Pricing
View Details
Ubiquitin Mouse Monoclonal Antibody (BF594)
orb1587714 100 µL

Ubiquitin Mouse Monoclonal Antibody (BF594)

Sign In for Pricing
View Details
PAE9 Antibody
orb793084 2 mg

PAE9 Antibody

Sign In for Pricing
View Details
Bovine alpha2-Antiplasmin(alpha2-AP) ELISA Kit
MBS2608667-01 48 Well

Bovine alpha2-Antiplasmin(alpha2-AP) ELISA Kit

Sign In for Pricing
View Details
Bovine alpha2-Antiplasmin(alpha2-AP) ELISA Kit
MBS2608667-02 96 Well

Bovine alpha2-Antiplasmin(alpha2-AP) ELISA Kit

Sign In for Pricing
View Details