Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Omega-hexatoxin-Hv1a protein

This Reptile Omega-hexatoxin-Hv1a protein spans the amino acid sequence from region 1-37aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Omega-atracotoxin-Hv1a Short name, AcTx-Hv1 Short name, Omega-AcTx-Hv1a

UniProt

P56207

Expression Region

1-37aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki-67 (Proliferating Cell Marker) (MKI67/2462), 0.2mg/mL
BNUB2462-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2462), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human KPNA2 Protein (His Tag)
PKSH032670-01 10 µg

Recombinant Human KPNA2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human KPNA2 Protein (His Tag)
PKSH032670-02 50 µg

Recombinant Human KPNA2 Protein (His Tag)

Sign In for Pricing
View Details
Ethyl Nitroacetate
TRC-E925215-25G 25 g

Ethyl Nitroacetate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS627827 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
LELP1 Mouse Monoclonal Antibody [Clone ID: OTI5A5]
CF808570 100 µg

LELP1 Mouse Monoclonal Antibody [Clone ID: OTI5A5]

Sign In for Pricing
View Details