Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Omega-hexatoxin-Hv1a protein

This Reptile Omega-hexatoxin-Hv1a protein spans the amino acid sequence from region 1-37aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Omega-atracotoxin-Hv1a Short name, AcTx-Hv1 Short name, Omega-AcTx-Hv1a

UniProt

P56207

Expression Region

1-37aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT1 Human Gene Knockout Kit (CRISPR)
KN201075BN 1 Kit

STAT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tsr1 Mouse Gene Knockout Kit (CRISPR)
KN518373 1 Kit

Tsr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-Avi-6His) Biotinylated
PKSH033919-01 20 µg

Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-Avi-6His) Biotinylated

Sign In for Pricing
View Details
Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-Avi-6His) Biotinylated
PKSH033919-02 100 µg

Recombinant Human Leukocyte Ig-Like Receptor B2/LILRB2/ILT4/CD85d (C-Avi-6His) Biotinylated

Sign In for Pricing
View Details
Human TBC1D13 activation kit by CRISPRa
GA110211 1 Kit

Human TBC1D13 activation kit by CRISPRa

Sign In for Pricing
View Details
Nano Spectrophotometer BSNA-203
BSNA-203 1 Unit

Nano Spectrophotometer BSNA-203

Sign In for Pricing
View Details