Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Omega-hexatoxin-Hv1a protein

This Reptile Omega-hexatoxin-Hv1a protein spans the amino acid sequence from region 1-37aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Omega-atracotoxin-Hv1a Short name, AcTx-Hv1 Short name, Omega-AcTx-Hv1a

UniProt

P56207

Expression Region

1-37aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEO1 pSer551 Rabbit Polyclonal Antibody
AP12974PU-N 400 µL

LEO1 pSer551 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thiomalic acid
TRC-T140510-1G 1 g

Thiomalic acid

Sign In for Pricing
View Details
Cholic Acid-d4
TRC-C432603-50MG 50 mg

Cholic Acid-d4

Sign In for Pricing
View Details
CEP68 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F6]
TA507023AM 100 µL

CEP68 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F6]

Sign In for Pricing
View Details
Maleimide
TRC-M124980-2G 2 g

Maleimide

Sign In for Pricing
View Details
[Bis(diphenylphosphino)ethane]dichloronickel
TRC-B430455-5G 5 g

[Bis(diphenylphosphino)ethane]dichloronickel

Sign In for Pricing
View Details