Bacterial iagB protein
This Bacterial iagB protein spans the amino acid sequence from region 20-160aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
IagB, STM2877Invasion protein IagB
UniProt
P0CL15
Expression Region
20-160aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
DCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A07732-1-iFluor647 100 µg
Anti-USP26 Antibody Picoband®, iFluor647 Conjugate
Sign In for Pricing
View Details 
MBS1010100-01 0.05 mg (E-Coli)
Recombinant Uromastyx hardwickii Hemoglobin subunit beta-2
Sign In for Pricing
View Details MBS1010100-02 0.2 mg (E-Coli)
Recombinant Uromastyx hardwickii Hemoglobin subunit beta-2
Sign In for Pricing
View Details MBS1010100-03 0.5 mg (E-Coli)
Recombinant Uromastyx hardwickii Hemoglobin subunit beta-2
Sign In for Pricing
View Details MBS1010100-04 0.05 mg (Yeast)
Recombinant Uromastyx hardwickii Hemoglobin subunit beta-2
Sign In for Pricing
View Details MBS1010100-05 0.05 mg (Baculovirus)
Recombinant Uromastyx hardwickii Hemoglobin subunit beta-2
Sign In for Pricing
View Details