Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli PTH protein

This E. coli PTH protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HPTH protein; Parathormone protein; Parathyrin protein; Parathyroid hormone 1 protein; Parathyroid hormone protein; PTH protein; PTH1 protein; PTH1 receptor protein; PTH1R protein; PTHR protein; PTHR1 protein; PTHY_HUMAN protein.

UniProt

P0A7D1

Expression Region

1-194aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAFKAQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Recombinant Canine CA9 Protein, His-tagged, Alexa Fluor 488 conjugated
CA9-1039CAF488 20 μg- 50 μg- 100 μg

Active Recombinant Canine CA9 Protein, His-tagged, Alexa Fluor 488 conjugated

Sign In for Pricing
View Details
Rat Otx2 ELISA Kit
EF019115 96 Tests

Rat Otx2 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Dppa4 shRNA (UAS) - Lentiviral mouse Dppa4 shRNA (UAS, iRFP) plasmid
GTR15187624 1 Vial

Lentiviral mouse Dppa4 shRNA (UAS) - Lentiviral mouse Dppa4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SEH1L Rabbit mAb Antibody
orb1952074 100 µL

SEH1L Rabbit mAb Antibody

Sign In for Pricing
View Details
Rubisco (Large Chain) Monoclonal Antibody
MBS8519690-01 0.1 mg

Rubisco (Large Chain) Monoclonal Antibody

Sign In for Pricing
View Details
Rubisco (Large Chain) Monoclonal Antibody
MBS8519690-02 0.1 mL (AF635)

Rubisco (Large Chain) Monoclonal Antibody

Sign In for Pricing
View Details