Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli PTH protein

This E. coli PTH protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HPTH protein; Parathormone protein; Parathyrin protein; Parathyroid hormone 1 protein; Parathyroid hormone protein; PTH protein; PTH1 protein; PTH1 receptor protein; PTH1R protein; PTHR protein; PTHR1 protein; PTHY_HUMAN protein.

UniProt

P0A7D1

Expression Region

1-194aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAFKAQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Bromoimidazo[1,2-a]pyridin-8-ol dihydrochloride
EFC35848 2.5 g

6-Bromoimidazo[1,2-a]pyridin-8-ol dihydrochloride

Sign In for Pricing
View Details
Human anti-Staphylococcus aureus LukAB IgM
A11A47-LAB-M 1 Each

Human anti-Staphylococcus aureus LukAB IgM

Sign In for Pricing
View Details
HSPA7, ID (Heat Shock 70kD Protein B, Putative Heat Shock 70kD Protein 7, HSP70B) (APC) discontinued
H1834-40M-APC 200 µL

HSPA7, ID (Heat Shock 70kD Protein B, Putative Heat Shock 70kD Protein 7, HSP70B) (APC) discontinued

Sign In for Pricing
View Details
RGD1565133 3'UTR GFP Stable Cell Line
TU269115 1.0 mL

RGD1565133 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PIK3R5 Antibody
MBS9506687-01 0.05 mL

PIK3R5 Antibody

Sign In for Pricing
View Details
PIK3R5 Antibody
MBS9506687-02 0.1 mL

PIK3R5 Antibody

Sign In for Pricing
View Details