Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PCNA protein

This Human PCNA protein spans the amino acid sequence from region 1-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclin

UniProt

P12004

Expression Region

1-261aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Thymosin beta-10 (TMSB10) ELISA Kit
AE14105HO-01 48 Tests

Horse Thymosin beta-10 (TMSB10) ELISA Kit

Sign In for Pricing
View Details
Horse Thymosin beta-10 (TMSB10) ELISA Kit
AE14105HO-02 96 Tests

Horse Thymosin beta-10 (TMSB10) ELISA Kit

Sign In for Pricing
View Details
Mmu-miR-7646-3p agomir
HY-R04041A-01 5 nmol

Mmu-miR-7646-3p agomir

Sign In for Pricing
View Details
Mmu-miR-7646-3p agomir
HY-R04041A-02 20 nmol

Mmu-miR-7646-3p agomir

Sign In for Pricing
View Details
80-well Microtube Rack, transparent
1217131 1 Unit

80-well Microtube Rack, transparent

Sign In for Pricing
View Details
SLC9A8 Protein Vector (Human) (pPM-C-His)
PV130153 500 ng

SLC9A8 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details