Bacterial ssaA1 protein
This Bacterial ssaA1 protein spans the amino acid sequence from region 27-255aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
SsaA1, SACOL2581, Staphylococcal secretory antigen ssaA1
UniProt
Q5HCY4
Expression Region
27-255aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Staphylococcus aureus (strain COL)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
27 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AEQNNNGYNSNDAQSYSYTYTIDAQGNYHYTWTGNWNPSQLTQNNTYYYNNYNTYSYNNASYNNYYNHSYQYNNYTNNSQTATNNYYTGGSGASYSTTSNNVHVTTTAAPSSNGRSISNGYASGSNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAASSGYTVNNTPKVGAIMQTTQGYYGHVAYVEGVNSNGSVRVSEMNYGHGAGVVTSRTISANQAGSYNFIH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
024708-01 48 Tests
Dopamine Receptor D1 (DRD1) BioAssayTM ELISA Kit (Human)
Sign In for Pricing
View Details 024708-02 96 Tests
Dopamine Receptor D1 (DRD1) BioAssayTM ELISA Kit (Human)
Sign In for Pricing
View Details 
MBS7031687-01 0.02 mg
Recombinant Mouse Transmembrane protein 199 (Tmem199)
Sign In for Pricing
View Details MBS7031687-02 0.1 mg
Recombinant Mouse Transmembrane protein 199 (Tmem199)
Sign In for Pricing
View Details MBS7031687-03 5x 0.1 mg
Recombinant Mouse Transmembrane protein 199 (Tmem199)
Sign In for Pricing
View Details