Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ssaA1 protein

This Bacterial ssaA1 protein spans the amino acid sequence from region 27-255aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SsaA1, SACOL2581, Staphylococcal secretory antigen ssaA1

UniProt

Q5HCY4

Expression Region

27-255aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain COL)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEQNNNGYNSNDAQSYSYTYTIDAQGNYHYTWTGNWNPSQLTQNNTYYYNNYNTYSYNNASYNNYYNHSYQYNNYTNNSQTATNNYYTGGSGASYSTTSNNVHVTTTAAPSSNGRSISNGYASGSNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAASSGYTVNNTPKVGAIMQTTQGYYGHVAYVEGVNSNGSVRVSEMNYGHGAGVVTSRTISANQAGSYNFIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SL agonist 1
HY-169020 1 Each

SL agonist 1

Sign In for Pricing
View Details
LRFN1 rabbit pAb Antibody
orb2304726-01 50 µL

LRFN1 rabbit pAb Antibody

Sign In for Pricing
View Details
LRFN1 rabbit pAb Antibody
orb2304726-02 100 µL

LRFN1 rabbit pAb Antibody

Sign In for Pricing
View Details
2-amidinothio-N- (2-indol-3-ylethyl) ethanamide, hydrochloride
ZAC89261 250 mg

2-amidinothio-N- (2-indol-3-ylethyl) ethanamide, hydrochloride

Sign In for Pricing
View Details
Superoxide Dismutase 2, Mitochondrial (Biotin)
550059 200 µL

Superoxide Dismutase 2, Mitochondrial (Biotin)

Sign In for Pricing
View Details
GLTSCR1 Protein Vector (Human) (pPB-C-His)
PV080849 500 ng

GLTSCR1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details