Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Wisp2 protein

This Mouse Wisp2 protein spans the amino acid sequence from region 24-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCN family member 5 Connective tissue growth factor-like protein Short name, CTGF-L

UniProt

Q9Z0G4

Expression Region

24-251aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-4 Rabbit Monoclonal Antibody
MA3243-.05 50 µL

Anti-IL-4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-GSG2/HASPIN Antibody Picoband® PE Conjugated
A31862-2-PE 100 µg/Vial

Anti-GSG2/HASPIN Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
Rat IgG1 (GL113) Isotype Control for In Vivo Ultra-Low Endotoxin
ICH2246UL-100mg 100 mg

Rat IgG1 (GL113) Isotype Control for In Vivo Ultra-Low Endotoxin

Sign In for Pricing
View Details
Recoverin (Cancer-associated Retinopathy Protein, Protein CAR, RCVRN, RCV1) (MaxLight 550)
132455-ML550 100 µL

Recoverin (Cancer-associated Retinopathy Protein, Protein CAR, RCVRN, RCV1) (MaxLight 550)

Sign In for Pricing
View Details
PLV3-CMV-E2F1-3xFLAG-CopGFP-Puro Plasmid
PVT79058 2 µg

PLV3-CMV-E2F1-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Mouse Stem Cell Factor (SCF) Mini Samples ELISA Kit
MBS2708259-01 24 Strip Well

Mouse Stem Cell Factor (SCF) Mini Samples ELISA Kit

Sign In for Pricing
View Details