Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat SARAF protein

This Rat SARAF protein spans the amino acid sequence from region 195-339aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBV X-transactivated gene 3 protein HBV XAg-transactivated protein 3 Protein FOAP-7 Transmembrane protein 66

UniProt

Q96BY9

Expression Region

195-339aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLXNA4 Antibody
A66849-50UG 50 µg

PLXNA4 Antibody

Sign In for Pricing
View Details
CD63 Rabbit mAb
E60M0495 100 µL

CD63 Rabbit mAb

Sign In for Pricing
View Details
Bovine Synaptophysin (SYP) ELISA Kit
RDR-SYP-b-96Tests 96 Tests

Bovine Synaptophysin (SYP) ELISA Kit

Sign In for Pricing
View Details
Chorionic Gonadotropin, Human, alpha (hCGa) (FITC) discontinued
C5069-60-FITC 100 µL

Chorionic Gonadotropin, Human, alpha (hCGa) (FITC) discontinued

Sign In for Pricing
View Details
RBM9 antibody - middle region (ARP40764_P050)
ARP40764_P050 100 µL

RBM9 antibody - middle region (ARP40764_P050)

Sign In for Pricing
View Details
HBM Recombinant Protein
OPCD03816-200UG 200 µg

HBM Recombinant Protein

Sign In for Pricing
View Details