Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il1f10 protein

This Mouse Il1f10 protein spans the amino acid sequence from region 1-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-1F10

UniProt

Q8R459

Expression Region

1-152aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPM2AIP1 Antibody Blocking Peptide
orb1512190 500 µg

EPM2AIP1 Antibody Blocking Peptide

Sign In for Pricing
View Details
ZNF693 Rabbit pAb, PerCP-Cy7 conjugated
orb2844696 100 µL

ZNF693 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
ABCG1, NT (ATP-binding Cassette Sub-family G Member 1, ATP-binding Cassette Transporter 8, White Protein Homolog, WHT1, ABC8) (MaxLight 550) discontinued
A0004-04M4-ML550 100 µL

ABCG1, NT (ATP-binding Cassette Sub-family G Member 1, ATP-binding Cassette Transporter 8, White Protein Homolog, WHT1, ABC8) (MaxLight 550) discontinued

Sign In for Pricing
View Details
GGG-C (AF647) C-Terminal Sortagging
CRB1110653-01 0.1 mg

GGG-C (AF647) C-Terminal Sortagging

Sign In for Pricing
View Details
GGG-C (AF647) C-Terminal Sortagging
CRB1110653-02 0.5 mg

GGG-C (AF647) C-Terminal Sortagging

Sign In for Pricing
View Details
CFI-401870
T30804-01 25 mg

CFI-401870

Sign In for Pricing
View Details