Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LHPP protein

This Human LHPP protein spans the amino acid sequence from region 1-270aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FLJ44846, FLJ46044, HDHD2B, hLHPP, lhpp, LHPP_HUMAN, Phospholysine phosphohistidine inorganic pyrophosphate phosphatase

UniProt

Q9H008

Expression Region

1-270aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hirudin (55-65) (sulfated)
H-7445.0001 1.0mg

Hirudin (55-65) (sulfated)

Sign In for Pricing
View Details
Silicatein, alpha (Suberites domuncula)
MBS622071-01 0.02 mL

Silicatein, alpha (Suberites domuncula)

Sign In for Pricing
View Details
Silicatein, alpha (Suberites domuncula)
MBS622071-02 0.1 mL

Silicatein, alpha (Suberites domuncula)

Sign In for Pricing
View Details
Silicatein, alpha (Suberites domuncula)
MBS622071-03 5x 0.1 mL

Silicatein, alpha (Suberites domuncula)

Sign In for Pricing
View Details
Oxytetracycline-13C, d3 (hydrochloride)
HY-W755036 1 mg

Oxytetracycline-13C, d3 (hydrochloride)

Sign In for Pricing
View Details
Pbrm1 3'UTR Luciferase Stable Cell Line
TU215850 1.0 mL

Pbrm1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details