Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish mt2 protein

This Fish mt2 protein spans the amino acid sequence from region 1-60aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MT-2

UniProt

Q7ZSY6

Expression Region

1-60aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPNMB Mouse Monoclonal Antibody [Clone ID: OTI8A10]
CF807721 100 µg

GPNMB Mouse Monoclonal Antibody [Clone ID: OTI8A10]

Sign In for Pricing
View Details
CUX2 (NM_015267) Human Tagged ORF Clone
RC222063 10 µg

CUX2 (NM_015267) Human Tagged ORF Clone

Sign In for Pricing
View Details
IL3RA Polyclonal Antibody, APC Conjugated
bs-2600R-APC-TR 20 µL

IL3RA Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Anti-Kv4.2 Antibody
MBS8247464-01 0.03 mL

Anti-Kv4.2 Antibody

Sign In for Pricing
View Details
Anti-Kv4.2 Antibody
MBS8247464-02 0.05 mL

Anti-Kv4.2 Antibody

Sign In for Pricing
View Details
Anti-Kv4.2 Antibody
MBS8247464-03 0.1 mL

Anti-Kv4.2 Antibody

Sign In for Pricing
View Details