Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish mt2 protein

This Fish mt2 protein spans the amino acid sequence from region 1-60aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MT-2

UniProt

Q7ZSY6

Expression Region

1-60aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD3G (NM_000073) AAV Particle
RC220512A1V 250 µL

Human CD3G (NM_000073) AAV Particle

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MAF1 Polyclonal Antibody
MBS7158694 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MAF1 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TLR5 Antibody (85B152.5) [HRP]
NBP1-97728H 0.1 mL

Mouse Monoclonal TLR5 Antibody (85B152.5) [HRP]

Sign In for Pricing
View Details
Rabbit Anti-IKBKE/IKKi/IKKe antibody
SL4114R-01 50 µL

Rabbit Anti-IKBKE/IKKi/IKKe antibody

Sign In for Pricing
View Details
Rabbit Anti-IKBKE/IKKi/IKKe antibody
SL4114R-02 100 µL

Rabbit Anti-IKBKE/IKKi/IKKe antibody

Sign In for Pricing
View Details
Snx2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6044603 1.0 µg DNA

Snx2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details