Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish mt2 protein

This Fish mt2 protein spans the amino acid sequence from region 1-60aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MT-2

UniProt

Q7ZSY6

Expression Region

1-60aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RBM19 Knockout HEK293T cell line
GTR15412186 1 Vial

Human RBM19 Knockout HEK293T cell line

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Rabbit Polyclonal Antibody
AP02121SU-N 100 µg

Myeloperoxidase (MPO) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cathepsin D shRNA Plasmid (m)
sc-29934-SH 20 µg

Cathepsin D shRNA Plasmid (m)

Sign In for Pricing
View Details
PLOD3, NT (PLOD3, Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3, Lysyl hydroxylase 3) (Azide free) (HRP) discontinued
040182-HRP 200 µL

PLOD3, NT (PLOD3, Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3, Lysyl hydroxylase 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Anti-human apoB mAbs (LDL 20/17), unconjugated
orb1532650 250 µg

Anti-human apoB mAbs (LDL 20/17), unconjugated

Sign In for Pricing
View Details
Sheep Platelet factor 3 ELISA Kit
MBS743727-01 48 Well

Sheep Platelet factor 3 ELISA Kit

Sign In for Pricing
View Details