Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ly6e protein

This Mouse Ly6e protein spans the amino acid sequence from region 21-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stem cell antigen 2 Thymic shared antigen 1 Short name, TSA-1

UniProt

Q64253

Expression Region

21-102aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCX3A (NM_016379) Human Tagged Lenti ORF Clone
RC221002L1 10 µg

VCX3A (NM_016379) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human LCLAT1 shRNA (UAS) - Lentiviral human LCLAT1 shRNA (UAS, GFP) (25)
GTR15319871 1 Vial

Lentiviral human LCLAT1 shRNA (UAS) - Lentiviral human LCLAT1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
DDX17 (H-7) HRP
sc-398168 HRP 200 µg/mL

DDX17 (H-7) HRP

Sign In for Pricing
View Details
KAP20.4 Polyclonal Antibody
MBS9236004-01 0.1 mL

KAP20.4 Polyclonal Antibody

Sign In for Pricing
View Details
KAP20.4 Polyclonal Antibody
MBS9236004-02 5x 0.1 mL

KAP20.4 Polyclonal Antibody

Sign In for Pricing
View Details
Mmu-miR-1930-3p antagomir
HY-RI02743A-01 5 nmol

Mmu-miR-1930-3p antagomir

Sign In for Pricing
View Details