Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ly6e protein

This Mouse Ly6e protein spans the amino acid sequence from region 21-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stem cell antigen 2 Thymic shared antigen 1 Short name, TSA-1

UniProt

Q64253

Expression Region

21-102aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BHLHB9/p60TRP Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-11653R-BF680 100 µL

BHLHB9/p60TRP Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Mouse Pimreg Pre-designed siRNA Set A
SI110581A 1 Each

Mouse Pimreg Pre-designed siRNA Set A

Sign In for Pricing
View Details
Indoleamine 2,3-Dioxygenase (IDO, CD107B, INDO, Indoleamine-pyrrole 2,3-dioxygenase) (HRP)
MBS6422705-01 0.1 mL

Indoleamine 2,3-Dioxygenase (IDO, CD107B, INDO, Indoleamine-pyrrole 2,3-dioxygenase) (HRP)

Sign In for Pricing
View Details
Indoleamine 2,3-Dioxygenase (IDO, CD107B, INDO, Indoleamine-pyrrole 2,3-dioxygenase) (HRP)
MBS6422705-02 5x 0.1 mL

Indoleamine 2,3-Dioxygenase (IDO, CD107B, INDO, Indoleamine-pyrrole 2,3-dioxygenase) (HRP)

Sign In for Pricing
View Details
Anti-hCD20-Ga-hIgG1
hcd20ga-mab1-3 3 x 100 µg

Anti-hCD20-Ga-hIgG1

Sign In for Pricing
View Details
Mouse Monoclonal LAT Antibody (661002) [Allophycocyanin]
FAB63341A 0.1 mL

Mouse Monoclonal LAT Antibody (661002) [Allophycocyanin]

Sign In for Pricing
View Details