Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Plbd2 protein

This Rat Plbd2 protein spans the amino acid sequence from region 36-585aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LAMA-like protein 2 Lamina ancestor homolog 2 Phospholipase B domain-containing protein 2

UniProt

Q4QQW8

Expression Region

36-585aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAFIPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDFLHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYMSMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPWD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Meyerozyma guilliermondii DNA mismatch repair protein MSH3 (MSH3), partial
MBS1003511 Inquire

Recombinant Meyerozyma guilliermondii DNA mismatch repair protein MSH3 (MSH3), partial

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) Nucleocapsid (N) Recombinant Protein Liquid 100UG
ICOV2NTR100UG 100 µg

SARS-CoV-2 (COVID-19) Nucleocapsid (N) Recombinant Protein Liquid 100UG

Sign In for Pricing
View Details
Sheep Colon Cancer Specific Antigene-3 ELISA Kit
MBS039746-01 48 Well

Sheep Colon Cancer Specific Antigene-3 ELISA Kit

Sign In for Pricing
View Details
Sheep Colon Cancer Specific Antigene-3 ELISA Kit
MBS039746-02 96 Well

Sheep Colon Cancer Specific Antigene-3 ELISA Kit

Sign In for Pricing
View Details
Sheep Colon Cancer Specific Antigene-3 ELISA Kit
MBS039746-03 5x 96 Well

Sheep Colon Cancer Specific Antigene-3 ELISA Kit

Sign In for Pricing
View Details
Sheep Colon Cancer Specific Antigene-3 ELISA Kit
MBS039746-04 10x 96 Well

Sheep Colon Cancer Specific Antigene-3 ELISA Kit

Sign In for Pricing
View Details