Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Podxl protein

This Rat Podxl protein spans the amino acid sequence from region 25-386aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Podocalyxin-like protein 1 , PC , PCLP-1

UniProt

Q9WTQ2

Expression Region

25-386aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDNGNKTDTSDITSIDQNQDKPATNQPSNATPKSSVQPPTPTSISTSSPDPKATQSSNSSVTTTSDSTTDRTSSSTSTVPTTSNSGQTVSSGGKSSDKITTALPTTLGPVNASSQPTDLNTSTKLPSTPTTNSTASPHQPVSHSEGQHTTVQSSSASVSSSDNTTLLWILTTSKPTGTSEGTQPIAISTPGITTPVSTPLQPTGSPGGTESVPTTEEFTHSTSSWTPVVSQGPSTPSSTWTSGSYKLKCDPAIKPHEELLILNLTRDSFCKGSPPNERFLELLCHSAKASFKPAEDSCALELAPILDNQAVAVKRIVIETKLSPKAVFELLKDKWDDLTEAGVIDIHLGKEGPPEVNEDRFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant BAP29 Monoclonal Antibody
AN301714L-01 50 µL

Recombinant BAP29 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant BAP29 Monoclonal Antibody
AN301714L-02 100 µL

Recombinant BAP29 Monoclonal Antibody

Sign In for Pricing
View Details
Calponin-1 (CALP + CNN1/832), CF594 conjugate, 0.1mg/mL
BNC940833-500 1x 500 µL

Calponin-1 (CALP + CNN1/832), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HGF (NM_001010933) Human Over-expression Lysate
LY423238 100 µg

HGF (NM_001010933) Human Over-expression Lysate

Sign In for Pricing
View Details
CD6 (3F7B5), CF405S conjugate, 0.1mg/mL
BNC040428-500 1x 500 µL

CD6 (3F7B5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Automatic Nitrogen Air Generator BGEN-501
BGEN-501 Each

Automatic Nitrogen Air Generator BGEN-501

Sign In for Pricing
View Details