Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCRG1 protein

This Human SCRG1 protein spans the amino acid sequence from region 21-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein , ScRG-1

UniProt

O75711

Expression Region

21-98aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (C4/206), 0.2mg/mL
BNUB0206-100 1x 100 µL

CD4 (C4/206), 0.2mg/mL

Sign In for Pricing
View Details
MFluor™ UV540 maleimide
1608-AAT 1 mg

MFluor™ UV540 maleimide

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF640R conjugate, 0.1mg/mL
BNC401670-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GJB6 Polyclonal Antibody
E-AB-15680-01 20 µL

GJB6 Polyclonal Antibody

Sign In for Pricing
View Details
GJB6 Polyclonal Antibody
E-AB-15680-02 60 µL

GJB6 Polyclonal Antibody

Sign In for Pricing
View Details
GJB6 Polyclonal Antibody
E-AB-15680-03 120 µL

GJB6 Polyclonal Antibody

Sign In for Pricing
View Details