Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Scrg1 protein

This Mouse Scrg1 protein spans the amino acid sequence from region 21-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein , ScRG-1

UniProt

O88745

Expression Region

21-98aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gelson ELISA kit
GTR10419657 96 Well

Mouse Gelson ELISA kit

Sign In for Pricing
View Details
RNF160, ID (LTN1, C21orf10, C21orf98, KIAA0714, RNF160, ZNF294, E3 ubiquitin-protein ligase listerin, RING finger protein 160, Zinc finger protein 294) (PE) discontinued
041122-PE 200 µL

RNF160, ID (LTN1, C21orf10, C21orf98, KIAA0714, RNF160, ZNF294, E3 ubiquitin-protein ligase listerin, RING finger protein 160, Zinc finger protein 294) (PE) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Dus1l shRNA (UAS) - Lentiviral mouse Dus1l shRNA (UAS, RFP) plasmid
GTR15169249 1 Vial

Lentiviral mouse Dus1l shRNA (UAS) - Lentiviral mouse Dus1l shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
ANAPC10P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0084106 1.0 µg DNA

ANAPC10P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CD32 Rabbit Polyclonal Antibody
orb13406-01 50 μL

CD32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD32 Rabbit Polyclonal Antibody
orb13406-02 100 µL

CD32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details