Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Scrg1 protein

This Mouse Scrg1 protein spans the amino acid sequence from region 21-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein , ScRG-1

UniProt

O88745

Expression Region

21-98aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl cedrene
T20795-01 25 mg

Acetyl cedrene

Sign In for Pricing
View Details
Acetyl cedrene
T20795-02 50 mg

Acetyl cedrene

Sign In for Pricing
View Details
Acetyl cedrene
T20795-03 100 mg

Acetyl cedrene

Sign In for Pricing
View Details
Rabbit synovial apoptosis inhibitor 1, synoviolin (SYVN1) ELISA Kit
MBS2613007-01 48 Well

Rabbit synovial apoptosis inhibitor 1, synoviolin (SYVN1) ELISA Kit

Sign In for Pricing
View Details
Rabbit synovial apoptosis inhibitor 1, synoviolin (SYVN1) ELISA Kit
MBS2613007-02 96 Well

Rabbit synovial apoptosis inhibitor 1, synoviolin (SYVN1) ELISA Kit

Sign In for Pricing
View Details
Rabbit synovial apoptosis inhibitor 1, synoviolin (SYVN1) ELISA Kit
MBS2613007-03 5x 96 Well

Rabbit synovial apoptosis inhibitor 1, synoviolin (SYVN1) ELISA Kit

Sign In for Pricing
View Details