Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral GP protein

This Viral GP protein spans the amino acid sequence from region 502-637aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GP1,2 , GP

UniProt

P87671

Expression Region

502-637aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Zaire ebolavirus (strain Eckron-76) (ZEBOV) (Zaire Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQNGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0090 ORF Vector (Human) (pORF)
25515011 1.0 µg DNA

KIAA0090 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Fruit fly DLG Rabbit Polyclonal Antibody (Fluoro488)
orb3089079 200 µL

Fruit fly DLG Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
SCRIBBLE (SCRIB) (NM_182706) Human Over-expression Lysate
LY405420 100 µg

SCRIBBLE (SCRIB) (NM_182706) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal MSL2L1 Antibody [DyLight 350]
NBP2-97602UV 0.1 mL

Rabbit Polyclonal MSL2L1 Antibody [DyLight 350]

Sign In for Pricing
View Details
KRIT1 CRISPR Activation Plasmid (m)
sc-429770-ACT 20 µg

KRIT1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Rabbit Polyclonal BRE Antibody [mFluor Violet 610 SE]
NBP1-76830MFV610 0.1 mL

Rabbit Polyclonal BRE Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details