Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral GP protein

This Viral GP protein spans the amino acid sequence from region 502-637aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GP1,2 , GP

UniProt

P87671

Expression Region

502-637aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Zaire ebolavirus (strain Eckron-76) (ZEBOV) (Zaire Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQNGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM120A Protein Vector (Human) (pPM-C-His)
PV042520 500 ng

TMEM120A Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human GNB2/Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 ELISA Kit
MBS2906618-01 48 Well

Human GNB2/Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 ELISA Kit

Sign In for Pricing
View Details
Human GNB2/Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 ELISA Kit
MBS2906618-02 96 Well

Human GNB2/Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 ELISA Kit

Sign In for Pricing
View Details
Human GNB2/Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 ELISA Kit
MBS2906618-03 5x 96 Well

Human GNB2/Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 ELISA Kit

Sign In for Pricing
View Details
Human GNB2/Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 ELISA Kit
MBS2906618-04 10x 96 Well

Human GNB2/Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 ELISA Kit

Sign In for Pricing
View Details
MRPS22 Rabbit Polyclonal Antibody (BF647)
orb2531788 100 µL

MRPS22 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details