Human TRIM24 protein
This Human TRIM24 protein spans the amino acid sequence from region 891-1012aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
E3 ubiquitin-protein ligase TRIM24RING finger protein 82Tripartite motif-containing protein 24
UniProt
O15164
Expression Region
891-1012aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
16.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7232836-01 48 Well
Mouse Cip1-interacting zinc finger protein (CIZ1) ELISA Kit
Sign In for Pricing
View Details MBS7232836-02 96 Well
Mouse Cip1-interacting zinc finger protein (CIZ1) ELISA Kit
Sign In for Pricing
View Details MBS7232836-03 5x 96 Well
Mouse Cip1-interacting zinc finger protein (CIZ1) ELISA Kit
Sign In for Pricing
View Details MBS7232836-04 10x 96 Well
Mouse Cip1-interacting zinc finger protein (CIZ1) ELISA Kit
Sign In for Pricing
View Details 
PB9377-Biotin 100 µg/Vial
Anti-HLA-C Antibody Picoband® (Biotine Conjugate)
Sign In for Pricing
View Details TYD-02990-01 10 mg
(3-Iodo-1- (tetrahydro-2H-pyran-2-yl) -1H-pyrazol-4-yl) methanol
Sign In for Pricing
View Details